General Information

  • ID:  hor006572
  • Uniprot ID:  Q21507
  • Protein name:  Probable insulin-like peptide alpha-type 1
  • Gene name:  ins-21
  • Organism:  Caenorhabditis elegans
  • Family:  Insulin family
  • Source:  animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:   Caenorhabditis (genus), Peloderinae (subfamily), Rhabditidae (family), Rhabditoidea (superfamily), Rhabditomorpha (infraorder), Rhabditina (suborder), Rhabditida (order), Chromadorea (class), Nematoda (phylum), Ecdysozoa , Protostomia , Bilateria , Eumetazoa , Metazoa (kingdom), Opisthokonta , Eukaryota (superkingdom),cellular organisms
  • GO MF:  NA
  • GO BP:  NA
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  KKHVRFLCATKAVKHIRKVCPDMCLTGEEVEVNEFCKMGYSDSQIKYICCPE
  • Length:  52
  • Propeptide:  MKTYSFFVLFIVFIFFISSSKSHSKKHVRFLCATKAVKHIRKVCPDMCLTGEEVEVNEFCKMGYSDSQIKYICCPE
  • Signal peptide:  MKTYSFFVLFIVFIFFISSSKSHS
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  NA
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  8-36; 20-49; 24-50
  • Structure ID:  AF-Q21507-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor006572_AF2.pdbhor006572_ESM.pdb

Physical Information

Mass: 692000 Formula: C261H421N71O75S8
Absent amino acids: W Common amino acids: KC
pI: 8.12 Basic residues: 11
Polar residues: 15 Hydrophobic residues: 14
Hydrophobicity: -26.35 Boman Index: -8526
Half-Life: 1.3 hour Half-Life Yeast: 3 min
Half-Life E.Coli: 2 min Aliphatic Index 69.23
Instability Index: 4267.31 Extinction Coefficient cystines: 3355
Absorbance 280nm: 65.78

Literature

  • PubMed ID:  9851916
  • Title:  Genome sequence of the nematode C. elegans: a platform for investigating biology.
  • PubMed ID:  9548970
  • Title:  New insulin-like proteins with atypical disulfide bond pattern characterized in Caenorhabditis elegans by comparative sequence analysis and homology modeling.